Sac Bandoulière 999 Black 
Sac Bandoulière  
Sac Bandoulière  
Sac Bandoulière  
Sac Bandoulière  
Authorized Retailer

Café En Terrasse Crossbody Bag Black

320€ VAT included
Reduced price Regular price
  • There are only 1 item(s) left in stock.
  • Out of stock
Loading...Free
Standard Delivery
Returns within 30 days
Leather goods seller since 1989
Secure payment
mobilepayklarnavisamasterpaypalapple_pay

Karl Lagerfeld Café En Terrasse Crossbody Bag - Iconic Crescent Design

This crossbody bag reveals a modern crescent silhouette, a signature of the Karl Lagerfeld style. Crafted from deep black supple leather, it features a sophisticated chain on the shoulder strap and the subtle KARL Autograph motif for a touch of fashion authenticity.

Design Features

  • Modern crescent shape: Distinctive contemporary silhouette
  • Premium supple leather: Noble material for a luxurious feel
  • Elegant chain: Metallic detail on the shoulder strap
  • KARL Autograph motif: Discreet iconic signature
  • Secure zip closure: Optimal protection for your belongings

Technical Specifications

  • Dimensions: 28.0 x 7.5 x 21.0 cm
  • Weight: 0.63 kg
  • Material: Supple leather

Style Tips Noir 999 Black

  • Urban chic look: Pair with an anthracite grey blazer and minimalist white sneakers
  • Casual outfit: Perfect with raw denim and a beige cashmere sweater
  • Sophisticated style: Complements a black midi dress and heeled ankle boots

Leather Care

  • Cleaning: Soft, slightly damp cloth, air dry
  • Nourishment: Leather cream every 3-6 months depending on usage
  • Storage: Dry and ventilated place, avoid direct sunlight exposure
Dimensions
21 × 8 × 28 cm≈ 2.5 L
Caractéristiques
Type
Half Moon Bag
Matière
Leather
Portée
Shoulder, Crossbody Bag
Fermeture
Zippered