Karl Lagerfeld Ikon Aquarelle Square Tote Bag Black
Karl Lagerfeld Ikon Aquarelle Square Tote Bag Black
Karl Lagerfeld Ikon Aquarelle Square Tote Bag Black
Karl Lagerfeld Ikon Aquarelle Square Tote Bag Black
Karl Lagerfeld Ikon Aquarelle Square Tote Bag Black
Authorized Retailer

Ikon Aquarelle Square Tote Bag Black

135€ VAT included
Reduced price Regular price
  • There are only 1 item(s) left in stock.
  • Out of stock
Loading...12€
Standard Delivery
Free from 140€
Returns within 30 days
Leather goods seller since 1989
Secure payment
mobilepayklarnavisamasterpaypalapple_pay

Karl Lagerfeld Ikon Aquarelle Square Tote Bag Black

Discover this square tote bag with a sleek design, enhanced by the signature Karl Lagerfeld IKON watercolor motif. Featuring dual handles and a detachable shoulder strap, this shopper adapts to all your needs, from daily errands to city outings. An essential accessory that combines elegance and practicality to complement your style throughout the seasons.
  • Twin handles and detachable shoulder strap for versatile styling
  • Structured, square-shaped silhouette
  • Karl IKON watercolor graphic on the front
  • Composition: 65% Recycled Cotton, 35% Cotton
  • Material: Woven
  • Made in: China
  • Dimensions: Height: 25 cm Length: 33 cm Width: 15.5 cm
  • Weight: 700 g
Dimensions
25 × 16 × 33 cm≈ 7.4 L
Caractéristiques
Type
Tote Bag
Portée
Hand, Shoulder, Crossbody Bag
Fermeture
Open