Karl Lagerfeld Ikon Signature Choupette Handbag Natural White
Karl Lagerfeld Ikon Signature Choupette Handbag Natural White
Karl Lagerfeld Ikon Signature Choupette Handbag Natural White
Karl Lagerfeld Ikon Signature Choupette Handbag Natural White
Karl Lagerfeld Ikon Signature Choupette Handbag Natural White
Autoriséierte Verkeefer

Ikon Signature Choupette Handbag Natural White

99€ Inklusiv TVA
Reduzéierte Präis Reguläre Präis
Faarf
  • Et sinn nach nëmmen 4 Stéck op Lager.
  • Ausverkaaft
Lueden...7,99€
Standard Liwwerung
Gratis Liwwerung vun 100€
Gratis Retour bannent 30 Deeg
Läderwarenverkeefer zënter 1989
Secure payment
paypalklarnaidealvisamasterapple_pay
Designed to be carried by hand or worn crossbody, this square handbag features a detachable strap for versatile styling. It is adorned with a bold Karl Signature and Ikon Choupette motif for a playful touch.
  • Contemporary square silhouette
  • Button closure to keep your essentials secure
  • Two top handles with a detachable and adjustable strap for versatile styling
  • Enhanced with contrasting Karl Signature and playful Ikon Choupette motifs
  • Composition: 65% Recycled cotton, 35% Cotton
  • Material: Knit
  • Made in: China
  • Height: 15 cm
  • Length: 18 cm
  • Width: 8 cm
  • Weight: 200 g
Dimensions
15 × 8 × 18 cm≈ 1.2 L
Caractéristiques
Type
Mini Sac
Portée
Hand, Schëllerbeutel
Fermeture
Drockknäppchen