Sac Bandoulière 1Xv Caramel 
Sac Bandoulière  
Sac Bandoulière  
Sac Bandoulière  
Sac Bandoulière  
Autoriséierte Verkeefer

A Vision Of The Future Crossbody Bag Brown

299€ Inklusiv TVA
Reduzéierte Präis Reguläre Präis
Faarf
  • Et sinn nach nëmmen 1 Stéck op Lager.
  • Ausverkaaft
Lueden...Gratis
Standard Liwwerung
Gratis Retour bannent 30 Deeg
Läderwarenverkeefer zënter 1989
Secure payment
paypalklarnaidealvisamasterapple_pay

Karl Lagerfeld A Vision Of The Future Crossbody Bag - Iconic Signature

This crossbody bag reveals a contemporary crescent silhouette, crafted from premium calf leather. The shoulder strap, adorned with chic chain details, offers comfortable wear while asserting your fashion-forward style. The delicate KARL Autograph motif provides that iconic signature sought after by fashion enthusiasts.

Design and Features

The secure zipper closure protects your essentials during urban commutes. This crescent shape naturally contours to the body, ensuring comfort and elegance for hands-free outings. A statement accessory that transforms every outfit into a style declaration.

Technical Specifications

  • Dimensions: 29.0 x 9.0 x 26.0 cm
  • Weight: 0.63 kg
  • Material: 100% calf leather

Caramel Brown Styling Tips

This caramel shade pairs perfectly with a beige blazer and cognac ankle boots for a sophisticated look. Match it with a terracotta midi dress and nude pumps for elegant outings, or wear it with raw denim and a cream sweater for a casual chic style.

Leather Care

Clean with a soft, slightly damp cloth and let it air dry naturally. Nourish the leather with a specialized cream every 3-6 months. Avoid direct sunlight exposure and store in a dry, ventilated place to preserve its beauty.

Dimensions
26 × 9 × 29 cm≈ 3.9 L
Caractéristiques
Type
Beutel mat Klapp
Matière
Lieder
Portée
Schëller, Schëllerbeutel
Fermeture
Zippéiert