Karl Lagerfeld Ikon Aquarelle Square Tote Bag Black
Karl Lagerfeld Ikon Aquarelle Square Tote Bag Black
Karl Lagerfeld Ikon Aquarelle Square Tote Bag Black
Karl Lagerfeld Ikon Aquarelle Square Tote Bag Black
Karl Lagerfeld Ikon Aquarelle Square Tote Bag Black
Autoriséierte Verkeefer

Ikon Aquarelle Square Tote Bag Black

129€ Inklusiv TVA
Reduzéierte Präis Reguläre Präis
Faarf
  • Et sinn nach nëmmen 1 Stéck op Lager.
  • Ausverkaaft
Lueden...Gratis
Standard Liwwerung
Gratis Retour bannent 30 Deeg
Läderwarenverkeefer zënter 1989
Secure payment
epsklarnapaypalvisamasterapple_pay

Karl Lagerfeld Ikon Aquarelle Square Tote Bag Black

Discover this square tote bag with a sleek design, enhanced by the signature Karl Lagerfeld IKON watercolor motif. Featuring dual handles and a detachable shoulder strap, this shopper adapts to all your needs, from daily errands to city outings. An essential accessory that combines elegance and practicality to complement your style throughout the seasons.
  • Twin handles and detachable shoulder strap for versatile styling
  • Structured, square-shaped silhouette
  • IKON Karl watercolor graphic on the front
  • Composition: 65% Recycled cotton, 35% Cotton
  • Material: Woven
  • Made in: China
  • Dimensions: Height: 25 cm Length: 33 cm Width: 15.5 cm
  • Weight: 700 g
Dimensions
25 × 16 × 33 cm≈ 7.4 L
Caractéristiques
Type
Shopper-Beutel
Portée
Hand, Schëller, Schëllerbeutel
Fermeture
Op

Entdecken Sie dieses Produkt in unseren Kollektionen