Affenzahn Sac À Dos 1 à 3 ans Petits Amis Elephant
Affenzahn Sac À Dos 1 à 3 ans Petits Amis Elephant - 2
Affenzahn Sac À Dos 1 à 3 ans Petits Amis Elephant - 3
Affenzahn Sac À Dos 1 à 3 ans Petits Amis Elephant - 4
Affenzahn Sac À Dos 1 à 3 ans Petits Amis Elephant - 5
Authorized Retailer

Little Friends Elephant Backpack 1-3 Years

45€ VAT included
Reduced price Regular price
  • In stock
  • Out of stock
Loading...7,99€
Standard Delivery
Free from 100€
Free returns within 30 days
Leather goods seller since 1989
Secure payment
paypalklarnaidealvisamasterapple_pay

Affenzahn Little Friends Elephant Backpack - Eco-Friendly Adventure

This Affenzahn Elephant backpack turns every outing into a responsible adventure. Specially designed for toddlers aged 1 to 3, it combines a playful design with environmental commitment, crafted from recycled plastic bottles.

Playful and Functional Design

The adorable elephant motif in blue captures children's imaginations while providing an educational playmate. The zipper, adapted for small hands, encourages independence, while the compact dimensions are perfectly suited to a young child's build.

Ecological Commitment

Made with 48% recycled polyester from PET bottles, this bag introduces children to environmental values from an early age. A responsible choice that blends fun with ecological awareness.

Technical Specifications

  • Dimensions: 17.0 x 11.0 x 25.0 cm
  • Weight: 0.2 kg
  • Material: 100% polyester, including 48% recycled

Care Instructions

Clean with a soft, slightly damp cloth. Allow to air dry naturally, away from any direct heat source. Store in a dry place to preserve the quality of the recycled materials.

Dimensions
25 × 11 × 17 cm≈ 2.6 L
Caractéristiques
Type
Backpack
Matière
Recycled Polyester
Portée
Back
Fermeture
Zippered