Affenzahn Sac À Dos 1 à 3 ans Petits Amis Bear
Affenzahn Sac À Dos 1 à 3 ans Petits Amis Bear - 2
Affenzahn Sac À Dos 1 à 3 ans Petits Amis Bear - 3
Affenzahn Sac À Dos 1 à 3 ans Petits Amis Bear - 4
Affenzahn Sac À Dos 1 à 3 ans Petits Amis Bear - 5
Authorized Retailer

Small Friends Bear Backpack 1-3 Years

45€ VAT included
Reduced price Regular price
  • There are only 1 item(s) left in stock.
  • Out of stock
Loading...7,99€
Standard Delivery
Free from 100€
Free returns within 30 days
Leather goods seller since 1989
Secure payment
paypalklarnaidealvisamasterapple_pay

Affenzahn Little Friends Bear Backpack - The Ecological Adventure

This Affenzahn backpack turns every outing into an adventure thanks to its charming bear design and eco-friendly construction. Specially designed for children aged 1 to 3 years, it combines safety, comfort, and respect for the environment.

Playful and Functional Design

The Bear motif captures the imagination of little ones while offering remarkable practicality. The zipper, adapted for small hands, encourages independence, while the adjustable straps ensure comfortable carrying.

Ecological Commitment

Made from recycled polyester sourced from PET bottles, this backpack raises children's awareness of environmental values from an early age. A responsible choice that preserves the planet for future generations.

Technical Specifications

  • Dimensions: 17.0 x 11.0 x 25.0 cm
  • Weight: 0.2 kg
  • Material: 100% polyester, including 48% recycled

Blue Bear Style Tips

This Blue Bear shade pairs perfectly with:

  • Beige outfit and white sneakers for a natural look
  • Red sweater and grey pants for a dynamic contrast
  • Mustard yellow outfit and brown shoes for an autumnal palette

Care and Durability

Clean with a soft, slightly damp cloth. Allow to air dry away from direct heat. Store in a dry place to preserve shape and colors.

Dimensions
25 × 11 × 17 cm≈ 2.6 L
Caractéristiques
Type
Backpack
Matière
Recycled Polyester
Portée
Back
Fermeture
Zippered

Discover this product in our collections