Lancel M Elles Handbag Black
Lancel M Elles Handbag Black
Lancel M Elles Handbag Black
Lancel M Elles Handbag Black
Lancel M Elles Handbag Black
Lancel M Elles Handbag Black
Authorized Retailer

M Elles Handbag Black

650€ VAT included
Reduced price Regular price
  • There are only 1 item(s) left in stock.
  • Out of stock

Genuine Leather

Loading...Free
Standard Delivery
Free returns within 30 days
Leather goods seller since 1989
Secure payment
epsklarnapaypalvisamasterapple_pay

Lancel ELLES Handbag - Geometric Femininity

The ELLES collection reveals a modern approach to Parisian leather goods, where clean geometry meets everyday functionality. This black cowhide leather handbag features the applied Double L motif with a gold finish, a distinctive signature of the Lancel house.

Design and Finishes

The structured silhouette offers a striking visual balance thanks to its sharp geometric lines. The full-grain cowhide leather develops a natural patina over time, while the hot-stamped logo with a gold finish adds a touch of sophisticated radiance.

Interior Layout

The interior organization prioritizes practicality with a spacious main compartment and a flat back pocket for essentials within reach. This configuration allows for optimal storage while preserving the bag's structured shape.

Technical Specifications

  • Dimensions: 30.0 x 33.0 x 14.0 cm
  • Weight: 0.725 kg
  • Material: 100% Cowhide Leather

Style Tips

The deep black harmonizes perfectly with an anthracite suit and nude pumps for the office, or with raw denim jeans and suede ankle boots for a chic casual look. For evenings, pair it with a navy sheath dress and metallic sandals.

Leather Care

Clean gently with a soft, slightly damp cloth and let it dry naturally. Nourish the leather with a specialized cream every 3 to 6 months depending on usage. Avoid direct sunlight exposure and store in a dry, ventilated place to preserve the quality of the leather.

Dimensions
33 × 14 × 30 cm≈ 8.0 L
Caractéristiques
Type
Bucket
Matière
Leather
Portée
Hand
Fermeture
Drawstring