Sac Bandoulière 1Xv Caramel 
Sac Bandoulière  
Sac Bandoulière  
Sac Bandoulière  
Sac Bandoulière  
Authorized Retailer

A Vision Of The Future Crossbody Bag Brown

299€ VAT included
Reduced price Regular price
  • There are only 1 item(s) left in stock.
  • Out of stock
Loading...Free
Standard Delivery
Free returns within 30 days
Leather goods seller since 1989
Secure payment
epsklarnapaypalvisamasterapple_pay

Karl Lagerfeld A Vision Of The Future Crossbody Bag - Iconic Signature

This crossbody bag reveals a contemporary crescent-moon silhouette, crafted from premium calf leather. The shoulder strap, adorned with chic chain details, offers a comfortable fit while asserting your fashion-forward style. The delicate KARL Autograph motif provides that iconic signature sought after by fashion enthusiasts.

Design and Features

The secure zipper closure protects your essentials during urban commutes. This crescent shape naturally contours to the body, ensuring comfort and elegance for hands-free outings. A statement accessory that transforms every outfit into a style declaration.

Technical Specifications

  • Dimensions: 29.0 x 9.0 x 26.0 cm
  • Weight: 0.63 kg
  • Material: 100% calf leather

Caramel Brown Styling Tips

This caramel shade pairs perfectly with a beige blazer and cognac ankle boots for a sophisticated look. Match it with a terracotta midi dress and nude pumps for elegant outings, or wear it with raw denim and a cream sweater for a casual chic style.

Leather Care

Clean with a soft, slightly damp cloth and let it air dry. Nourish the leather with a specialized cream every 3-6 months. Avoid direct sunlight exposure and store in a dry, ventilated place to preserve its beauty.

Dimensions
26 × 9 × 29 cm≈ 3.9 L
Caractéristiques
Type
Half Moon Bag
Matière
Leather
Portée
Shoulder, Crossbody Bag
Fermeture
Zippered